PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30128.m009035
Common NameLOC8275014, RCOM_1437600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family NAC
Protein Properties Length: 254aa    MW: 29014.8 Da    PI: 9.1967
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30128.m009035genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.6e-52141381128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+evd++k++PwdLp      e+e yfFs+r+ ky++g+r+nrat+sgyWkatg dke++++ 
  30128.m009035  14 LPPGFRFHPTDEELVVQYLKRKVFSCPLPA-SIIPEVDVCKSDPWDLPGD---LEQERYFFSTREAKYPNGNRSNRATSSGYWKATGIDKEIVTSk 105
                    79****************************.89***************54...46799*********************************99985 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++lvg+kktLvfy+g+ p+g++tdW+mheyrl
  30128.m009035 106 GNQLVGMKKTLVFYRGKPPHGTRTDWIMHEYRL 138
                    7778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-6110173IPR003441NAC domain
PROSITE profilePS5100558.10814173IPR003441NAC domain
PfamPF023652.0E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MERLNFVKNG VLRLPPGFRF HPTDEELVVQ YLKRKVFSCP LPASIIPEVD VCKSDPWDLP  60
GDLEQERYFF STREAKYPNG NRSNRATSSG YWKATGIDKE IVTSKGNQLV GMKKTLVFYR  120
GKPPHGTRTD WIMHEYRLVS PQTAACNSPQ KKNPIQSPLG AMDNWVLCRI FLKKRSNKNE  180
EDNLHIGNEN RVCKLRNTKP VFYEFLTKDR TDLNLAPCSS SSGSSGITEV SSNESDDHEE  240
SSSCNSFPYF RRKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-531217815170NO APICAL MERISTEM PROTEIN
1ut4_B6e-531217815170NO APICAL MERISTEM PROTEIN
1ut7_A6e-531217815170NO APICAL MERISTEM PROTEIN
1ut7_B6e-531217815170NO APICAL MERISTEM PROTEIN
3swm_A6e-531217818173NAC domain-containing protein 19
3swm_B6e-531217818173NAC domain-containing protein 19
3swm_C6e-531217818173NAC domain-containing protein 19
3swm_D6e-531217818173NAC domain-containing protein 19
3swp_A6e-531217818173NAC domain-containing protein 19
3swp_B6e-531217818173NAC domain-containing protein 19
3swp_C6e-531217818173NAC domain-containing protein 19
3swp_D6e-531217818173NAC domain-containing protein 19
4dul_A6e-531217815170NAC domain-containing protein 19
4dul_B6e-531217815170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0175650.0KF017565.1 Hevea brasiliensis NAC transcription factor (NAC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512632.10.0PREDICTED: NAC domain-containing protein 83
SwissprotQ9FY931e-104NAC83_ARATH; NAC domain-containing protein 83
TrEMBLB9RFW30.0B9RFW3_RICCO; NAC domain-containing protein, putative
STRINGPOPTR_0003s16490.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-100NAC domain containing protein 83